View Plans
3D Model: blue multi compartment shelf filled with vintage toys globes books
avataradriansaputra996
02-05 10:33
Model Name

stylized shelf 3d model

Tags
furniturefurniture game assetfurniture game asset stylizedfurniture stylizedgame assetgame asset stylizedkeepsakemerchandiseraftakishelfstylizedthree shelfvintage
Input
Input image: Front view
Front
Input image: Left view
Left
Input image: Back view
Back
Input image: Right view
Right
Related Models
3d model: bunny girl cosplay character with blue bodysuit pink bow and white e3d model: standard mug with silly funny face on it that has the aesthetics of d3d model: square table with black top and silver metal legs3d model: two girls with pink hair in mustard sweaters sit and pose holding pho3d model: female character in a purple black bodysuit with white sleeves3d model: slightly stylized businesswoman figure in a professional outfit with b3d model: ornate wooden carved panel with dragon scroll motif brown wood detai3d model: dark blue sci fi cargo crate with reinforced panels and metallic textu3d model: white modular cabinet system with multiple shelves and a central desk3d model: slatted cylindrical furniture piece with vertical fins in maroon color
Enter invite code to get credits!