View Plans
3D Model: dwarven warrior miniature with sword and shield on snowy rocky base
avatardanielandreuferrer
03-14 11:50
Model Name

fantasy dwarf 3d model

Tags
armadura debearded dwarfcharactercharacter fantasycharacter game assetcharacter game asset fantasydwarf blacksmithdwarvenfantasyfantasy dwarfgame assetgame asset fantasysword shaped
Input
Input image for 3D model generation
Prompt
Related Models
3d model: pink dress cat eared girl stylized character with gold accents3d model: Spider Man black suit figure with web motif and spider emblem on chest3d model: Weathered ancient lava sailing ship with tribal tattoos among cherry3d model: bull in chase scene with human athlete on sandy ground cartoon 3D mod3d model: cartoon boy character in brown outfit posed in T pose with simple shad3d model: barbarian warrior miniature with double headed axe on rocky base deta3d model: chibi girl figure with cream dress and cardigan pink handbag black h3d model: please make the bottom of the surface in sphere form so this looks a c3d model: stylized father holding child figurine with glasses brown hair maroo3d model: wooden crate with metal corner braces brown wood planks and grey meta
Enter invite code to get credits!