View Plans
3D Model: glam eye wear logo text with gold and silver gradient lettering
avatargolandogeonseo
01-02 06:56
Model Name

glam eye wear logo 3d

Tags
abstract symbolabstract symbol realisticabstract symbol renderingabstract symbol rendering realisticbeige goldeyelinereyewearfacepieceglamorousrealisticrenderingrendering realisticsilver gray
Input
Input image for 3D model generation
Prompt
Related Models
3d model: red rounded blob with black outline3d model: Blue demonic creature with ornate gold armor multiple spiked limbs h3d model: neon drawn djinn logo emblem with teal outline and orange glow3d model: life size female statue with dress on pedestal white marble texture3d model: female figure wearing black sleeveless top and red leather pants stan3d model: orange geometric sculpture abstract metal art with layered panels3d model: ornate fantasy warrior figure in white robe and black armor with gold3d model: platano3d model: ornate circular metal disc with cross motif and engraved runes bronze3d model: circular text logo with concentric rings spelling SECRETBASE black an
Enter invite code to get credits!