View Plans
3D Model: mechanical press assembly with flywheel and crank linkage on blue hous
avatarAnonymous1761062348
10-21 16:01
Model Name

mechanical press 3d model

Tags
concept artconcept art realisticcrankcrankshaftflywheelmachinemachine concept artmachine concept art realisticmachine realisticmechanicalmechanical lookingmechanical pressrealistictorque wrench
Input
Input image for 3D model generation
Prompt
Related Models
3d model: mythic goddess statue with white gown and gold jewelry on ornate pedes3d model: beige motorhome with Valencia branding side door windows and wheels3d model: stylized armored mecha figure with pink wings gold and white plating3d model: brown chocolate vegan plant protein powder bag with white text and gol3d model: orange and yellow mecha robot with large rounded hips armored torso3d model: athletic male figure with defined musculature wearing shorts grayscal3d model: golden eagle emblem with three stars and Arabic inscription3d model: white jagged burst in wood with black outlines over wooden planks3d model: alien creature with elongated neck antennae ribbed torso ink sketch3d model: sepia toned skeletal creature with elongated limbs and wing like appen
Enter invite code to get credits!