View Plans
3D Model: red and black handheld obdii scanner device with colored display and b
avatarAnonymous1773044785
04-10 08:15
Model Name

car diagnostic tool 3d model

Tags
devicehandheldkeypadmachinemachine realisticmachine renderingmachine rendering realisticrealisticrenderingrendering realisticscanner
Input
Input image: Front view
Front
Input image: Left view
Left
Input image: Back view
Back
Input image: Right view
Right
Related Models
3d model: Minimalist glass whale with ribbon accents on a frozen lake3d model: Greek classical marble arcane orb with crystal growths3d model: large power transformer with cooling radiators high voltage bushings3d model: ai training kiosk with display screen instructional panels and manne3d model: industrial machinery rig with tubes pipes and straps on pallet3d model: round red pendant with coffee cup motif white interior 4 cm diameter3d model: elderly woman wearing green top with oxygen tubing3d model: Golden Penny Foods badge with green ribbon orange circular seal featu3d model: neon heart sign with cursive text and red glow3d model: Steampunk granite satellite with layered plates among cherry blossoms
Enter invite code to get credits!