?

3D Model: round keycap keyboard with beige keys and black lettering
avatarAnonymous1774364470
03-25 15:11
Model Name

round keycap keyboard 3d model

Tags
key shapedkeycapllavemachinemachine realisticmachine renderingmachine rendering realisticpiano keyrealisticrenderingrendering realisticteclado
Input
Input image for 3D model generation
Prompt
Related Models
3d model: woman wearing black sweater and jeans with belt chain accessory chok3d model: white circular plastic spacer with central hollow post and vertical in3d model: friendly robot mascot with green accents and recycling motif glossy p3d model: woman wearing a pink striped shirt with dark hair portrait3d model: blue solar panels on metal support frames forming rows in a solar farm3d model: green suburban house with attached garage teal siding red tile roof3d model: Ninja kitchen blender with glass jar control panel and metal base3d model: stitched plush figure with zipper torso brown fabric texture blue bu3d model: futuristic control console with blue holographic display and radar UI3d model: yellow cartoon robot with large eyes smiling face giving thumbs up
Enter invite code to get credits!