?

3D Model: rusted steam engine with large flywheels and exposed gears on a heavy
avatarJake Tellestio
09-19 09:06
Model Name

rusty steam engine 3d model

Tags
crankshaftflywheelsmachinemachine realisticmachine renderingmachine rendering realisticmoteurrealisticrenderingrendering realisticrustedsteam enginesteam powered
Input
Input image for 3D model generation
Prompt
Related Models
3d model: round white pink humanoid robot with a black face screen waving hand3d model: man in black suit taking mirror selfie3d model: circular prison arena with iron gates central circular platform rust3d model: ornate coffin with carved wood silver embellishments red rose petals3d model: orange and white hollow rectangular prisms with a central rectangular3d model: ornate bookshelf with decorative scrollwork and arch top five shelves3d model: ThinkPad laptop exploded view diagram showing components and assembly3d model: Create a futuristic transparent 3D human face mesh for Driver Monitori3d model: marble lotus relief panel with carved floral motif architectural orna3d model: orange and purple dirt bike with rider in black gear
Enter invite code to get credits!