?

3D Model: wide leg pants featuring cloud and dragon motif gradient from gray to
avatarAnonymous1767018462
12-30 14:38
Model Name

pants 3d model

Tags
clothingclothing renderingclothing rendering stylizedclothing stylizeddress shapedlegwearminifaldapantspantyhoseplush texturedrenderingrendering stylizedslender stilettostylizedwide leg pants
Input
Input image for 3D model generation
Prompt
Related Models
3d model: Pastel pink doll figure with cat companion wearing a pink outfit and3d model: bear plush sitting with folded limbs beige fur rounded ears soft te3d model: hospital gown with light blue geometric pattern fabric3d model: humanoid cyborg inside a glass energy capsule with blue neural lightin3d model: stone goblet on a tall pedestal with gold bands and diamond shaped orn3d model: white cropped jacket with zip front puffed long sleeves and collar3d model: white furry earflap hat with stitched patches and long tassel like ear3d model: viking dwarf warrior with horned helmet fur cloak and dual axes3d model: black over ear headphones with yellow sun logo on the earcup cushione3d model: metal mask with tribal engravings in silver and red
Enter invite code to get credits!